PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.LSD4Q
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family MYB_related
Protein Properties Length: 300aa    MW: 33593.6 Da    PI: 7.3731
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.LSD4QgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.81.1e-124488147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +WT+ E++++++a +++  + Wk+I + +g  +t  q++s+ qky
      Aradu.LSD4Q 44 RENWTEPEHDKFLEALQLFDRD-WKKIGAFVG-SKTVIQIRSHAQKY 88
                     789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466899.72E-163894IPR009057Homeodomain-like
PROSITE profilePS5129414.7683993IPR017930Myb domain
TIGRFAMsTIGR015572.8E-174291IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.4E-54384IPR009057Homeodomain-like
SMARTSM007171.1E-104391IPR001005SANT/Myb domain
PfamPF002493.2E-104488IPR001005SANT/Myb domain
CDDcd001674.18E-84689No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MVSKNPNPPE GXXXXXXXXX VSAPNSAEDA AKKIRKPYTI TKSRENWTEP EHDKFLEALQ  60
LFDRDWKKIG AFVGSKTVIQ IRSHAQKYFI KVQKSGTSEH LPPPRPKRKA AHPYPQKASK  120
NAPLLSQLSE SFQSSSALLE SGYVLKHDPS TMLKTPIMNT VVPSWSNSTL QTTNLLHVPK  180
VNDPSGSSES TPRVQPGDES NGQGNSSFPL RVLPDFTQVY SFIGSVFDPN TTDHLHKLKN  240
MDRIDVETVL LLMRNLSVNL TSPDFEDHRK VLSTYEVELD TDDYINADIL QDDQLKSAAT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF2086810.0KF208681.1 Arachis hypogaea putative MYB-related protein 27 (MYB27) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015967346.10.0PREDICTED: protein REVEILLE 6-like
SwissprotQ8H0W31e-108RVE6_ARATH; Protein REVEILLE 6
TrEMBLV5T7180.0V5T718_ARAHY; Putative MYB-related protein 27
STRINGGLYMA16G29740.11e-158(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11193396
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.25e-89MYB_related family protein